← Back to Events
Sunday, May 22, 2011privacymedialawmedianewspapers

Scottish newspaper's identification of injunction footballer: a legal view

Scottish law traditionally required that "interdicts" – the equivalent of injunctions – were served on a party in order for them to take effect. Unless an individual or company was served with an interdict, they were not bound by it and were not restricted in what they could say or write. That position changed with the 1987 Spycatcher case, in which the government sought to prevent the British press from publishing details of the memoirs of a former MI5 officer, Peter Wright. In that case, the House of Lords suggested that the interdicts were wider-reaching: the Lords intimated that if you were aware of the injunction, even if you were not served with it, it would be against the spirit of an injunction to publish any information contravening it and that doing so would be a contempt of court. Scots lawyers have since understood the comments made by judges in the Spycatcher case to mean that it is possible for Scottish news outlets to breach an English injunction if they are aware of the injunction. Arguing that an injunction was not served on you when you are aware of it simply is not a defence. A further concern for the paper's directors is that they might face personal liability for the paper's breach of the injunction. If the Scottish newspaper's directors have connections with English companies in the same paper group on whom the injunction is binding, there is a risk that legal action could be taken against people at the top of the company. It was a bold, if somewhat surprising, decision to publish such information, knowing what the injunction restricted. Such actions could expose the paper to costly legal proceedings, with the added possibility of personal sanctions against the paper's directors. It may, however, bolster the argument that the player's identity is further in the public domain making a renewed challenge to the injunction more likely. Campbell Deane is a partner at a Scottish media law firm, Bannatyne Kirkwood France & Co.

Source: The Guardian ↗

Market Reactions

Price reaction data not yet calculated.

Available after full seed + reaction pipeline runs.

Similar Historical Events

No strong historical parallels found (score < 0.65).